Cart summary

You have no items in your shopping cart.

Human VEGF (121 a.a.) (Sf9) Protein

SKU: orb429177

Description

Recombinant of human VEGF (121 a.a.) (Sf9) protein

Images & Validation

Application Notes
Cytokines And Growth Factors

Key Properties

SourceSf9, Insect Cells
Biological ActivityMeasured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 2-10ng/ml.
Protein SequenceAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR
PurityGreater than 95.0% as determined by SDS-PAGE.

Storage & Handling

StorageStability: Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesThe protein was lyophilized from a solution containing 50mM acetic acid.
DisclaimerFor research use only

Alternative Names

Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human VEGF (121 a.a.) (Sf9) Protein (orb429177)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

2 μg
¥ 3,250.00
10 μg
¥ 4,550.00
1 mg
¥ 87,230.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry