Human VEGF (121 a.a.) (Sf9) Protein

SKU: orb429177

Description

Recombinant of human VEGF (121 a.a.) (Sf9) protein

Images & Validation

−

Application Notes	Cytokines And Growth Factors

Key Properties

−

Source	Sf9, Insect Cells
Biological Activity	Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 2-10ng/ml.
Protein Sequence	APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR
Purity	Greater than 95.0% as determined by SDS-PAGE.

Storage & Handling

−

Storage	Stability: Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Buffer/Preservatives	The protein was lyophilized from a solution containing 50mM acetic acid.
Disclaimer	For research use only

Alternative Names

−

Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols