You have no items in your shopping cart.
IL2 Protein
SKU: orb1476876
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Lama glama (Llama) |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 17.0 kDa |
| Expression Region | 21-154aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | APTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRMLTFKFYMPKKATELKHLQCLMEELKPLEEVLNLAQSKNSHLTNIKDSMNNINLTVSELKGSETGFTCEYDDETVTVVEFLNKWITFCQSIYSTMT |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−(IL-2)(T-cell growth factor)(TCGF)
Similar Products
−- Item 1 of 8
ZEB1/NIL2A Rabbit Polyclonal Antibody [orb6954]
FC, IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Gallus, Porcine, Rabbit
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 5
- Item 1 of 1
Rat Interleukin-2 Receptor alpha chain (IL-2Rα/CD25) ELISA Kit [orb1806969]
Rat
78.13-5000pg/mL
46.88 pg/mL
48 T, 96 T - Item 1 of 1
- Item 1 of 1
Mouse IL2 Inducible T-Cell Kinase (ITK) ELISA Kit [orb780647]
Mouse
0.32-20 ng/mL
0.116 ng/mL
96 T, 48 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
IL2 Protein (orb1476876)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days