Cart summary

You have no items in your shopping cart.

KCNQ1 Rabbit Polyclonal Antibody

SKU: orb329835

Description

Rabbit polyclonal antibody to KCNQ1

Research Area

Protein Biochemistry, Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHamster, Human, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human KCNQ1
TargetKCNQ1
Protein SequenceSynthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS
Molecular Weight60kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti LQT antibody, anti RWS antibody, anti WRS antibody, anti LQT1 antibody, anti SQT2 antibody, anti ATFB1 antibody, anti ATFB3 antibody, anti JLNS1 antibody, anti KCNA8 antibody, anti KCNA9 antibody, anti Kv1.9 antibody, anti Kv7.1 antibody, anti KVLQT1 antibody

Similar Products

  • KCNQ1 Rabbit Polyclonal Antibody [orb389421]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • KCNQ1 Rabbit Polyclonal Antibody [orb329798]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Hamster, Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • KCNQ1 Antibody (Center) [orb39638]

    FC,  WB

    Other, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    80 μl
  • KCNQ1 rabbit pAb Antibody [orb772907]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • KCNQ1 Antibody [orb1280163]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

KCNQ1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

KCNQ1 Rabbit Polyclonal Antibody

Lanes: 100 ug CHO cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody Dilution: 1:25000, Gene Name: KCNQ1.

KCNQ1 Rabbit Polyclonal Antibody

WB Suggested Anti-KCNQ1 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_861463

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

KCNQ1 Rabbit Polyclonal Antibody (orb329835)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 6,890.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry