You have no items in your shopping cart.
KP1
SKU: orb1147094
Description
Images & Validation
−
Key Properties
−| Molecular Weight | 3228.48 Da |
|---|---|
| Protein Sequence | H-Phe-Gln-Gly-Thr-Phe-Pro-Asp-Gly-Phe-Leu-Trp-Ala-Val-Gly-Ser-Ala-Ala-Tyr-Gln-Thr-Glu-Gly-Gly-Trp-Gln-Gln-His-Gly-Lys-Gly-OH |
| Purity | > 95% by HPLC |
Storage & Handling
−| Storage | Store dry, frozen and in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Disclaimer | For research use only |
Alternative Names
−FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG, KP-1,, KP1, KP1 (human), Klotho-derived peptide 1PP290
Similar Products
−
CD68 (Macrophage Marker) Antibody [orb1713215]
Feline, Human, Monkey, Mouse, Rat
Mouse
Monoclonal
Unconjugated
0.1 mlCD68 (Macrophage Marker) Antibody [orb1712524]
Feline, Human, Monkey, Mouse, Rat
Mouse
Monoclonal
Unconjugated
0.5 ml
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
KP1 (orb1147094)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days