Cart summary

You have no items in your shopping cart.

LYN Rabbit Polyclonal Antibody

SKU: orb330772

Description

Rabbit polyclonal antibody to LYN

Research Area

Cell Biology, Molecular Biology, Protein Biochemistry, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LYN
TargetLYN
Protein SequenceSynthetic peptide located within the following region: DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF
Molecular Weight58kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FLJ26625 antibody, anti JTK8 antibody, anti p53Lyn antibody, anti p56Lyn antibody

Similar Products

  • Phospho-Lyn (Tyr397) Rabbit Polyclonal Antibody [orb6340]

    IF,  IHC-Fr,  IHC-P,  WB

    Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-Lyn (Tyr507) Rabbit Polyclonal Antibody [orb106011]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Feline, Gallus, Guinea pig, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • Lyn Rabbit Polyclonal Antibody [orb402462]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Lyn Rabbit Polyclonal Antibody [orb6338]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • HCLS1 Antibody (C-term) [orb1936192]

    IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

LYN Rabbit Polyclonal Antibody

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

LYN Rabbit Polyclonal Antibody

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

LYN Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

LYN Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

LYN Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

LYN Rabbit Polyclonal Antibody

Rabbit Anti-LYN Antibody, Catalog Number: orb330772, Formalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

LYN Rabbit Polyclonal Antibody

WB Suggested Anti-LYN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate, LYN is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002341

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

LYN Rabbit Polyclonal Antibody (orb330772)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry