You have no items in your shopping cart.
MICALL1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Goat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MICALL1 |
| Target | MICALL1 |
| Protein Sequence | Synthetic peptide located within the following region: ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVP |
| Molecular Weight | 93kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−MICALL1 Rabbit Polyclonal Antibody [orb1993156]
ELISA, FC, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgMICALL1 Rabbit Polyclonal Antibody (Biotin) [orb2110510]
IHC, WB
Goat, Human
Rabbit
Polyclonal
Biotin
100 μlMICALL1 Rabbit Polyclonal Antibody (FITC) [orb2110509]
IHC, WB
Goat, Human
Rabbit
Polyclonal
FITC
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. MICALL1 is supported by BioGPS gene expression data to be expressed in HEK293T.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. MICALL1 is supported by BioGPS gene expression data to be expressed in HepG2.

Positive control (+): Human Placenta (PL), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 0.5 ug/ml.

Rabbit Anti-MICALL1 Antibody, Catalog Number: orb581401, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-MICALL1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
Documents Download
Request a Document
Protocol Information
MICALL1 Rabbit Polyclonal Antibody (orb581401)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review













