You have no items in your shopping cart.
MMP9 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MMP9 |
| Target | MMP9 |
| Protein Sequence | Synthetic peptide located within the following region: VAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTR |
| Molecular Weight | 78 kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−MMP9 Rabbit Polyclonal Antibody [orb100620]
ELISA, IF, IHC-Fr, IHC-P, WB
Equine, Gallus, Mouse, Porcine, Rabbit, Rat, Sheep
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlMMP9 Rabbit Polyclonal Antibody [orb1294373]
IF, IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 25 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. MMP9 is cleaved from 78 kDa to an approximately 66 kDa mature form.

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

MMP9 in humanprostate cancer was detected using HRP/AEC red color stain. Dilution: 2-15 ug/ml.

WB Suggested Anti-MMP9 Antibody Titration: 1.25 ug/ml, Positive Control: K562 cell lysate.
Documents Download
Request a Document
Protocol Information
MMP9 Rabbit Polyclonal Antibody (orb574506)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review























