You have no items in your shopping cart.
Mouse IL-10 protein
SKU: orb1216249
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Mouse |
| Target | IL-10 |
| Molecular Weight | 18.8 kDa |
| Protein Length | 170.0 |
| Protein Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (170) |
| Purity | 98% |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Disclaimer | For research use only |
Similar Products
−- Item 1 of 1
- Item 1 of 1
Mouse Il10 protein [orb594838]
Greater than 95% as determined by SDS-PAGE.
18.9 kDa
E.coli
1 mg, 500 μg, 50 μg, 10 μg - Item 1 of 1
Mouse IL10 protein (Active) [orb359015]
> 97% as determined by SDS-PAGE and HPLC.
18.7 kDa
E.Coli
100 μg, 500 μg, 10 μg Recombinant Mouse IL10 Protein, N-His [orb2963218]
>90% as determined by SDS-PAGE.
21.05 kDa
1 mg, 100 μg, 50 μg- Item 1 of 1
Recombinant mouse IL-10 protein, N-His (HEK293) [orb1516603]
>90% as determined by SDS-PAGE
20.6 kDa
100 μg, 500 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
IL-10
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse IL-10 protein (orb1216249)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days