You have no items in your shopping cart.
Mouse IL4 protein (Active)
SKU: orb359010
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant prolifiration of Murine HT-2 cells is less then 2 ng/ml, corresponding to a Specific Activity of > 5.0 x 10 ^ 5 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 13.5 kDa |
| Expression Region | 21-140aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | M+HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered , PBS, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−B cell growth factor 1 protein, B cell IgG differentiation factor protein, B Cell Stimulatory Factor 1 protein, B-cell stimulatory factor 1 protein, BCGF 1 protein, BCGF1 protein, Binetrakin protein, BSF 1 protein, BSF-1 protein, BSF1 protein, IGG1 induction factor protein, IL 4 protein, IL-4 protein, IL4 protein, Interleukin 4 protein, Interleukin 4 variant 2 protein, Interleukin 4, isoform 1 protein, Interleukin-4 protein, Interleukin4 protein, Lymphocyte stimulatory factor 1 protein, Macrophage fusion factor protein, Mast cell growth factor 2 protein, Pitrakinra protein
Similar Products
−Recombinant Mouse Interleukin-4 protein(Il4) (Active) [orb1650627]
>97% as determined by SDS-PAGE and HPLC.
13.5 kDa
20 μg, 100 μg, 500 μg, 1 mg, 5 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse IL4 protein (Active) (orb359010)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review