You have no items in your shopping cart.
Mouse PDGF B protein
SKU: orb594768
Featured
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using Balb/c3T3 mouse fibroblast cells is 1.55 ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 13.4 kDa |
| Expression Region | 82-190aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 4 mM HCl |
| Disclaimer | For research use only |
Alternative Names
−Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; PDGFB; PDGF2; SIS
Similar Products
−- Item 1 of 1
Recombinant Mouse CD140b/PDGFRB Protein, N-His [orb2964374]
>90% as determined by SDS-PAGE.
22.38 kDa
1 mg, 100 μg, 50 μgRecombinant Mouse PDGFD Protein, N-His [orb2964424]
>90% as determined by SDS-PAGE.
17.16 kDa
1 mg, 100 μg, 50 μgMouse SCDGFB protein [orb755705]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
38.1 kDa
E.Coli
100 μg, 200 μg, 50 μg, 1 mgMouse pdgf-B protein [orb1292285]
ELISA, WB
Greater than 90% by SDS-PAGE gel analyses
14.1 kDa
E.Coli
200 μg, 100 μg, 50 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse PDGF B protein (orb594768)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks