You have no items in your shopping cart.
MXI1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MXI1 |
| Target | MXI1 |
| Protein Sequence | Synthetic peptide located within the following region: LNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM |
| Molecular Weight | 26kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Mxi1 Rabbit Polyclonal Antibody [orb576104]
WB
Bovine, Canine, Equine, Guinea pig, Porcine, Rat
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlMXI1 Rabbit Polyclonal Antibody [orb573782]
WB
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlMXI1 Rabbit Polyclonal Antibody [orb2954286]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgMXI1 polyclonal antibody [orb641872]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Positive control (+): Mouse Brain (M-BR), Negative control (-): Mouse Kidney (M-KI), Antibody concentration: 3 ug/ml.

IHC Suggested Anti-MXI1 antibody, Titration: 5 ug/ml, Positive Control: Lung, respiratory epithelium.

Rabbit Anti-MXI1 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Epithelial cells of bronchiole, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-MXI1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.
Documents Download
Request a Document
Protocol Information
MXI1 Rabbit Polyclonal Antibody (orb573783)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





