You have no items in your shopping cart.
NSP16 (SARS-CoV-2) Antibody
SKU: orb1463315
Description
Images & Validation
−
| Tested Applications | WB |
|---|---|
| Dilution Range | WB:1:500-1:2,000 |
| Reactivity | Virus |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Affinity purified recombinant fusion protein using the N-terminal of Nsp16 (residues 1 to 140) and produced in E. coli.. Antigen Sequence: MSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNV |
| Target | NSP16 (SARS-CoV-2) |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−methyltransferase, Nsp16 SARS Coronavirus-2 antibody.
Similar Products
−SARS-CoV-2 (COVID-19) NSP16 polyclonal antibody [orb1272803]
ELISA
Virus
Rabbit
Polyclonal
Unconjugated
0.1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
NSP16 (SARS-CoV-2)
Documents Download
Datasheet
Product Information
Request a Document
NSP16 (SARS-CoV-2) Antibody (orb1463315)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review