You have no items in your shopping cart.
P9R
SKU: orb1140591
Description
Research Area
Infectious Disease & Virology
Images & Validation
−
Key Properties
−| Molecular Weight | 3412.1 Da |
|---|---|
| Protein Sequence | H-Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg-OH |
| Purity | > 95% by HPLC |
Storage & Handling
−| Storage | Store dry, frozen and in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−MERS-CoV CV060, NGAICWGPCPTAFRQIGNCGRFRVRCCRIR, P9R, SARS-CoV, SARS-CoV-2, antiviral activity, avian influenza, coronavirus, defensin, peptide, rhinovirus
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
P9R (orb1140591)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review