Cart summary

You have no items in your shopping cart.

P9R

SKU: orb1140591

Description

Defensin like peptide with potent antiviral activity; Antimicrobial peptides.

Research Area

Infectious Disease & Virology

Images & Validation

Key Properties

Molecular Weight3412.1 Da
Protein SequenceH-Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg-OH
Purity> 95% by HPLC

Storage & Handling

StorageStore dry, frozen and in the dark
Form/AppearanceFreeze dried solid
DisclaimerFor research use only

Alternative Names

MERS-CoV CV060, NGAICWGPCPTAFRQIGNCGRFRVRCCRIR, P9R, SARS-CoV, SARS-CoV-2, antiviral activity, avian influenza, coronavirus, defensin, peptide, rhinovirus
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

P9R (orb1140591)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

1 mg
¥ 5,070.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry