PDGFB Rabbit Polyclonal Antibody

SKU: orb584021

Description

PDGFB Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PDGFB. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human PDGFB. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Guinea pig, Mouse, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 7

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Guinea pig, Mouse, Rat, Sheep

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human PDGFB
Target	PDGFB
Protein Sequence	Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD
Molecular Weight	27kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

SIS, SSV, IBGC5, PDGF2, c-sis, PDGF-2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

PDGFB

UniProt

P01127

RefSeq (Protein):NP_002599

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_002599

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry