You have no items in your shopping cart.
Peptide YY (3-36) (human)
SKU: orb1147055
Description
Images & Validation
−
Key Properties
−| Molecular Weight | 4049.6 Da |
|---|---|
| Protein Sequence | H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Purity | > 95% by HPLC |
Storage & Handling
−| Storage | Store dry, dark and frozen |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, 126339-09-1GH120, PYY (3-36), PYY1-36, Y2 receptor agonist, appetite , food intake, metabolite, weight gain
Similar Products
−- Item 1 of 2
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Peptide YY (3-36) (human) (orb1147055)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days