Cart summary

You have no items in your shopping cart.

Porcine CCL3L1 protein

SKU: orb1216345

Description

The Swine CCL3L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL3L1 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL3L1 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL3L1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA) (Gene ID: 494459).

Images & Validation

Key Properties

SourceYeast
Biological OriginSwine
TargetCCL3L1
Molecular Weight7.8 kDa
Protein Length70.0
Protein SequenceAPLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
DisclaimerFor research use only

Alternative Names

LD78

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Porcine CCL3L1 protein (orb1216345)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
¥ 3,900.00
25 μg
¥ 7,020.00
100 μg
¥ 17,420.00
500 μg
¥ 55,380.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry