Cart summary

You have no items in your shopping cart.

PRDX1 Rabbit Polyclonal Antibody

SKU: orb330556

Description

Rabbit polyclonal antibody to PRDX1

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PRDX1
TargetPRDX1
Protein SequenceSynthetic peptide located within the following region: SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV
Molecular Weight22kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti MSP23 antibody, anti NKEFA antibody, anti PAG antibody, anti PAGA antibody, anti PAGB antibody, anti PRX1 antibody, anti TDPX2 antibody, anti PRXI antibody

Similar Products

  • Peroxiredoxin 1/PRDX1 Rabbit Polyclonal Antibody [orb251531]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • PRX I rabbit pAb Antibody [orb767060]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Peroxiredoxin 1 Rabbit Polyclonal Antibody [orb6796]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • PRDX1 Rabbit pAb Antibody [orb763658]

    IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • 2 Cys Peroxiredoxin Rabbit Polyclonal Antibody [orb186711]

    IF,  IHC-Fr,  IHC-P

    Equine, Mouse, Porcine, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PRDX1 Rabbit Polyclonal Antibody

PRDX1 antibody - N-terminal region (orb330556) validated by WB using 2. mouse brain extracts (80 ug), 3. rat brain extract (80 ug) at 2 ug/ml.

PRDX1 Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Human brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.

PRDX1 Rabbit Polyclonal Antibody

WB Suggested Anti-PRDX1 Antibody, Positive Control: Lane 1: 20 ug human dental pulp stem cell lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-AP, Secondry Antibody Dilution: 1:500.

PRDX1 Rabbit Polyclonal Antibody

WB Suggested Anti-PRDX1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002565

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

PRDX1 Rabbit Polyclonal Antibody (orb330556)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry