Cart summary

You have no items in your shopping cart.

Primate IFN beta protein

SKU: orb1215753

Description

The Gibbon IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Gibbon IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Gibbon IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Gibbon IFN beta Specifications: (Molecular Weight: 20.1 kDa) (Amino Acid Sequence: MSYNLLGFLQRRSSFQCQKLLWQLNGKLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAVFRQDLSSTGWNETIVENLLANVYHQIDHLKTVLEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTVVRVEILRNFFFINRLTGYLRN (166)) (Gene ID: 100598986).

Images & Validation

Key Properties

SourceYeast
Biological OriginGibbon
TargetIFN beta
Molecular Weight20.1 kDa
Protein Length166.0
Protein SequenceMSYNLLGFLQRRSSFQCQKLLWQLNGKLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAVFRQDLSSTGWNETIVENLLANVYHQIDHLKTVLEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTVVRVEILRNFFFINRLTGYLRN (166)
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Primate IL 6 Protein [orb429415]

    Greater than 97.0% as determined by SDS-PAGE and HPLC analyses.

    Escherichia Coli

    0.1 mg, 10 μg, 2 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Primate IFN beta protein (orb1215753)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
¥ 3,900.00
25 μg
¥ 7,020.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry