PVRL2/CD112 Antibody

SKU: orb1536657

Description

Images & Validation

−

Item 1 of 2

Tested Applications	IF, IHC, IHC-P, WB
Dilution range	IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
Reactivity	Human
Application Notes	Further information: The predicted MW is 51kDa/57kDa, while the observed MW by Western blot was 72kDa.

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 382-479 of human PVRL2 (NP_002847.1). FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV
Target	PVRL2 / CD112
Purification	Affinity purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Concentration	1.22 mg/ml
Disclaimer	For research use only

Alternative Names

−

PVRL2, HVEB, Herpesvirus entry protein B, Poliovirus receptor-like 2, Nectin-2, PRR2, PVRR2, CD112, CD112 antigen, Herpes virus entry mediator B, Herpesvirus entry mediator B, NECTIN2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Immunofluorescence analysis of HeLa cells.

Western blot analysis of extracts of various cell lines.

Quick Database Links

Gene Symbol

PVRL2 / CD112

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

IHC-P

Immunohistochemistry Paraffin

View Protocol

Immunofluorescence

View Protocol

Find More Protocols