Cart summary

You have no items in your shopping cart.

PVRL2/CD112 Antibody

SKU: orb1536657

Description

PVRL2/CD112 Antibody

Images & Validation

Tested ApplicationsIF, IHC, IHC-P, WB
Dilution RangeIF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
ReactivityHuman
Application Notes
Further information: The predicted MW is 51kDa/57kDa, while the observed MW by Western blot was 72kDa.

Key Properties

HostRabbit
ClonalityPolyclonal
IsotypeIgG
ImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 382-479 of human PVRL2 (NP_002847.1). FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV
TargetPVRL2 / CD112
PurificationAffinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesPBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Concentration1.22 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

PVRL2, HVEB, Herpesvirus entry protein B, Poliovirus receptor-like 2, Nectin-2, PRR2, PVRR2, CD112, CD112 antigen, Herpes virus entry mediator B, Herpesvirus entry mediator B, NECTIN2
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PVRL2/CD112 Antibody

Immunofluorescence analysis of HeLa cells.

PVRL2/CD112 Antibody

Western blot analysis of extracts of various cell lines.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol
IF
Immunofluorescence
View Protocol

PVRL2/CD112 Antibody (orb1536657)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

50 μl
¥ 8,320.00
DispatchUsually dispatched within 2-3 weeks
Bulk Enquiry