You have no items in your shopping cart.
PVRL2/CD112 Antibody
SKU: orb1536657
Description
Images & Validation
−Item 1 of 2
| Tested Applications | IF, IHC, IHC-P, WB |
|---|---|
| Dilution range | IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000) |
| Reactivity | Human |
| Application Notes |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 382-479 of human PVRL2 (NP_002847.1). FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV |
| Target | PVRL2 / CD112 |
| Purification | Affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol |
| Concentration | 1.22 mg/ml |
| Disclaimer | For research use only |
Alternative Names
−PVRL2, HVEB, Herpesvirus entry protein B, Poliovirus receptor-like 2, Nectin-2, PRR2, PVRR2, CD112, CD112 antigen, Herpes virus entry mediator B, Herpesvirus entry mediator B, NECTIN2

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Immunofluorescence analysis of HeLa cells.

Western blot analysis of extracts of various cell lines.
Quick Database Links
Gene Symbol
PVRL2 / CD112
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC
Immunohistochemistry
IHC-P
Immunohistochemistry Paraffin
IF
Immunofluorescence
PVRL2/CD112 Antibody (orb1536657)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review