You have no items in your shopping cart.
Recombinant Bovine coronavirus Non-structural protein of 12.7 kDa (5a)
SKU: orb1096628
Featured
Description
Research Area
Microbiology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV) |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 15.1 kDa |
| Expression Region | 1-109aa |
| Protein Length | Full Length |
| Protein Sequence | MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVHG |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−ns12.7, 12.7 kDa accessory protein
Similar Products
−Recombinant Bovine coronavirus Non-structural protein of 12.7 kDa (5a) [orb1096619]
Greater than 85% as determined by SDS-PAGE.
18.2 kDa
Baculovirus
1 mg, 100 μg, 20 μgRecombinant Bovine coronavirus Non-structural protein of 12.7 kDa (5a) [orb1096627]
Greater than 90% as determined by SDS-PAGE.
15.1 kDa
E.coli
1 mg, 20 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Bovine coronavirus Non-structural protein of 12.7 kDa (5a) (orb1096628)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

