You have no items in your shopping cart.
Recombinant Human Insulin-like growth factor I (IGF1) (E51R) (Active)
SKU: orb2657922
Featured
Active
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect ≤1.5 ng/mL. |
| Tag | Tag free |
| Molecular Weight | 9 kDa |
| Expression Region | MFPAMPLSSLFVN+49-118aa(E51R) |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | ≤10 EU/mg by the LAL method |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Insulin-like growth factor I (IGF1) (E51R) (Active) (orb2657922)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review