Recombinant Human Interleukin-12 subunit alpha (IL12A)

SKU: orb2659504

Featured

Description

This Recombinant Human Interleukin-12 subunit alpha (IL12A) spans the amino acid sequence from region 23-219aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Cancer Biology

Images & Validation

−

Item 1 of 1

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	E.coli
Biological Origin	Homo sapiens (Human)
Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Molecular Weight	27.6 kDa
Expression Region	23-219aa
Protein Length	Full Length of Mature Protein
Protein Sequence	RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Purity	Greater than 95% as determined by SDS-PAGE.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Disclaimer	For research use only

Alternative Names

−

IL-12A;Cytotoxic lymphocyte maturation factor 35 kDa subunit;CLMF p35;IL-12 subunit p35;NK cell stimulatory factor chain 1;NKSF1

Human IL-12 [orb3002466]

Purity:	SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (QC verified)
MW:	Predicted: 22.5&34.7 KDa. Observed: 25-38&40-50 KDa, reducing conditions

Sizes Available: 50 μg, 500 μg, 1 mg, 10 μg

Recombinant Human IL12A/IL-12 p35/NKSF1 Protein, C-Strep [orb2968763]
Purity:
>90% as determined by SDS-PAGE.
MW:
27.83 kDa
Sizes Available: 1 mg, 100 μg, 50 μg
Item 1 of 1
Human IL-12 Protein [orb1471767]
Conjugation:
Unconjugated
Purity:
Greater than 95% as determined by reducing SDS-PAGE.
MW:
22.5and34.7 KDa
Source:
Mammalian
Sizes Available: 50 μg, 10 μg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Recombinant Human Interleukin-12 subunit alpha (IL12A)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P29459

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols