Recombinant Human Interleukin-7 (IL7)

SKU: orb3053848

Description

Images & Validation

−

Application Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Tag	C-terminal 10xHis-tagged
Molecular Weight	18.9 kDa
Expression Region	26-177aa
Protein Length	Full Length of Mature Protein
Protein Sequence	DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxins	Not test

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Disclaimer	For research use only

Alternative Names

−

IL-7

Similar Products

−

Human IL-7 [orb3002429]

Purity:	SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)
MW:	Predicted: 17.5 KDa. Observed: 18 KDa, reducing conditions

Sizes Available: 10 μg, 50 μg, 500 μg, 1 mg

Human IL-7 [orb3002479]
Purity:
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
MW:
Predicted: 18.4 KDa. Observed: 19-30 KDa, reducing conditions
Sizes Available: 10 μg, 50 μg, 1 mg, 500 μg
IL7 (NM_000880) Human Recombinant Protein [orb3034646]
Purity:
> 80% as determined by SDS-PAGE and Coomassie blue staining
MW:
17.3 kDa
Sizes Available: 50 μg, 1 mg
Recombinant Human IL7 Protein, C-His [orb2969186]
Purity:
>90% as determined by SDS-PAGE.
MW:
18.64 kDa
Sizes Available: 1 mg, 100 μg, 50 μg
Item 1 of 1
Human IL-7 Protein [orb1471778]
Conjugation:
Unconjugated
Purity:
Greater than 95% as determined by reducing SDS-PAGE.
MW:
17.5 KDa
Source:
Mammalian
Sizes Available: 50 μg, 10 μg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

P13232

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols