You have no items in your shopping cart.
Recombinant Human Novel Coronavirus Spike glycoprotein(S) (K417N),partial
SKU: orb1096690
Featured
Description
Research Area
Epigenetics, Infectious Diseases, Non-Animal
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 27.8 kDa |
| Expression Region | 319-541aa(K417N) |
| Protein Length | Partial |
| Protein Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−E2 Peplomer protein
Similar Products
−Recombinant Human Novel Coronavirus Spike glycoprotein(S) (K417N),partial [orb1096689]
Greater than 85% as determined by SDS-PAGE.
54.4 kDa
Mammalian cell
20 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Novel Coronavirus Spike glycoprotein(S) (K417N),partial (orb1096690)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
