You have no items in your shopping cart.
Recombinant Human Sodium-dependent phosphate transport protein 2A (NPT2A), partial
SKU: orb3005033
Description
Images & Validation
−
Key Properties
−| Expression System | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 186-347 |
| Protein Length | 162 |
| Protein Sequence | PIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHITRLVVASFNIHGGRDAPDLLKIITEPFTKLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLPD |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxins | Not test |
Storage & Handling
−| Storage | Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Disclaimer | For research use only |
Alternative Names
−Sodium-dependent phosphate transport protein 2A; Sodium-phosphate transport protein 2A; Na(+-dependent phosphate cotransporter 2A; NaPi-3; Sodium/phosphate cotransporter 2A; Na(+/Pi cotransporter 2A; NaPi-2a; Solute carrier family 34 member 1; SLC34A1 NPT2 SLC17A2
Similar Products
−Recombinant Human Sodium-dependent phosphate transport protein 2A (NPT2A), partial [orb3011188]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Sodium-dependent phosphate transport protein 2A (NPT2A), partial, Biotinylated [orb3006265]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Sodium-dependent phosphate transport protein 2A (NPT2A), partial [orb3007498]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Sodium-dependent phosphate transport protein 2A (NPT2A), partial, Biotinylated [orb3008730]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Sodium-dependent phosphate transport protein 2A (NPT2A), partial [orb3009961]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Sodium-dependent phosphate transport protein 2A (NPT2A), partial (orb3005033)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review