Cart summary

You have no items in your shopping cart.

Recombinant Mouse IL-6

SKU: orb623197

Description

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.

Images & Validation

Application Notes
The Mouse IL-10 protein can be used in cell culture, as an IL-10 ELISA Standard, and as a Western Blot Control.

Key Properties

SourceYeast
Molecular Weight21.7 kDa
Protein SequenceFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
DisclaimerFor research use only

Similar Products

  • Mouse IL-6 [orb2994610]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)

    Predicted: 21.8 KDa. Observed: 22 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant mouse IL-6 protein, C-His [orb1516900]

    >95% as determined by SDS-PAGE

    26 kDa

    100 μg, 20 μg, 500 μg
  • Mouse IL-6 [orb3002517]

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 22.6 KDa. Observed: 20-38 KDa, reducing conditions

    1 mg, 500 μg, 50 μg, 10 μg
  • Recombinant Mouse IL6 Protein, C-Strep [orb2964792]

    >90% as determined by SDS-PAGE.

    25.26 kDa

    1 mg, 100 μg, 50 μg
  • Recombinant Mouse CD126/IL6R/IL-6RA Protein, C-Fc [orb2964827]

    >90% as determined by SDS-PAGE.

    65.64 kDa

    1 mg, 100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Recombinant Mouse IL-6 (orb623197)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
¥ 5,330.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry