You have no items in your shopping cart.
Recombinant Mouse TNF alpha
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Molecular Weight | 17.3 kDa |
| Protein Sequence | LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Disclaimer | For research use only |
Similar Products
−Human TNF RII [orb2994890]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 46.44 KDa. Observed: 60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgMouse PTX3 [orb2993117]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.
Predicted: 43.4 KDa. Observed: 54 KDa, reducing conditions
1 mg, 10 μg, 50 μg, 500 μgRecombinant Mouse Tumor necrosis factor (Tnf), partial (Active) [orb2992185]
Greater than 95% as determined by SDS-PAGE.
18.7 kDa
Mammalian cell
1 mg, 100 μg, 20 μgMouse TNF alpha [orb3002486]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (QC verified)
Predicted: 16.4 KDa. Observed: 14 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Request a Document
Protocol Information
Recombinant Mouse TNF alpha (orb623196)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
