You have no items in your shopping cart.
Recombinant Mouse TNF alpha
SKU: orb623196
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Molecular Weight | 17.3 kDa |
| Protein Sequence | LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Disclaimer | For research use only |
Similar Products
−Human TNF RII [orb2994890]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 46.44 KDa. Observed: 60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgMouse PTX3 [orb2993117]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.
Predicted: 43.4 KDa. Observed: 54 KDa, reducing conditions
1 mg, 10 μg, 50 μg, 500 μg- Item 1 of 2
Recombinant Mouse Tumor necrosis factor (Tnf), partial (Active) [orb2992185]
Greater than 95% as determined by SDS-PAGE.
18.7 kDa
Mammalian cell
1 mg, 100 μg, 20 μg Mouse TNF alpha [orb3002486]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (QC verified)
Predicted: 16.4 KDa. Observed: 14 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Mouse TNF alpha (orb623196)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days