You have no items in your shopping cart.
Recombinant Murine Tumor Necrosis Factor-alpha (rMuTNF-α)
SKU: orb1494916
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia coli. |
|---|---|
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is 1×107 units/mg. |
| Molecular Weight | Approximately 17.3 kDa. The recombinant murine TNF-alpha is a soluble 157 amino acid protein which corresponds to C-terminal extracellular domain of the full length transmembrane protein. |
| Protein Sequence | MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVY SQVLFKGQGC PDYVLLTHTV SRFAISYQEKVNLLSAVKSP CPKDTPEGAE LKPWYEPIYL GGVFQLEKGD QLSAEVNLPK YLDFAESGQV YFGVIAL |
| Purification | >97% by SDS-PAGE and HPLC analyses. |
| Purity | >97% by SDS-PAGE and HPLC analyses. |
| Endotoxins | Less than 1EU/mg of rMuTNF-α as determined by LAL method. |
Storage & Handling
−| Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized from a 0.2mm filtered solution in PBS, pH 7.2. |
| Buffer/Preservatives | Lyophilized from a 0.2mm filtered solution in PBS, pH 7.2. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Murine Tumor Necrosis Factor-alpha (rMuTNF-α) (orb1494916)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review