Cart summary

You have no items in your shopping cart.

Recombinant Rat APRIL

SKU: orb623200

Description

A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. Rat APRIL Recombinant Protein is purified APRIL (TNFSF13) produced in yeast.

Images & Validation

Application Notes
The Mouse FGF basic protein can be used in cell culture, as a FGF basic ELISA Standard, and as a Western Blot Control.

Key Properties

SourceYeast
Molecular Weight16.4 kDa
Protein SequenceAVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYL LYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDI ITVKIPRANAKLSLSPHGTFLGFVKL (146)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Rat APRIL protein [orb1216247]

    98%

    16.4 kDa

    Yeast

    500 μg, 100 μg, 5 μg, 25 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Recombinant Rat APRIL (orb623200)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
¥ 5,330.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry