Cart summary

You have no items in your shopping cart.

RecombinantIL-18BP,Human

SKU: orb1494713

Description

Interleukin-18 binding protein, also known as IL-18BP and tadekinig-alfa, is a secreted glycoprotein that contains an Ig-like C2-type domain. It is expressed in heart, lung, placenta and spleen. IL-18BP functions as an inhibitor of the proinflammatory cytokine IL-18. It binds to IL-18, prevents the binding of IL-18 to its receptor, and thus blocks IL-18-induced IFN-gamma production. The complete Ig domain has been shown to mediate the binding and neutralizing properties. IFN-gamma is able to upregulate the expression of IL-18BP, indicating that IL-18 activity is regulated by a feedback mechanism through IL-18BP.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

SourceCHO
Biological ActivityED50 < 30 ng /ml, measured in a bioassay using KG-1 cells in the presence of 50ng/ml Human IL-18.
Molecular Weight42-44 kDa, observed by reducing SDS-PAGE.
Protein SequenceTPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHL PGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSP QQQG
Purification> 95% as analyzed by SDS-PAGE and HPLC.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Endotoxins< 0.2 EU/μg, determined by LAL method.

Storage & Handling

StorageLyophilized recombinant Human IL-18BP remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human IL-18BP should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
DisclaimerFor research use only

Alternative Names

Interleukin-18 Binding Protein; IL18 BP
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

RecombinantIL-18BP,Human (orb1494713)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
¥ 2,340.00
50 μg
¥ 3,770.00