You have no items in your shopping cart.
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | HEK 293 |
|---|---|
| Biological Activity | The EC50 value of rat MCP-1/CCL2 on Caˆ2+ mobilization assay in CHO-K1/G15/rCCR2 cells (human G15 and rat CCR2 stably expressed in CHO-K1 cells) is less than 0.3 μg/ml. |
| Molecular Weight | 10~15 kDa, observed by reducing SDS-PAGE. |
| Protein Sequence | QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWV QKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVT SMTEN |
| Purification | > 98% as analyzed by SDS-PAGE. |
| Purity | > 98% as analyzed by SDS-PAGE. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage & Handling
−| Storage | Lyophilized recombinant Rat MCP-1°CCL2 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat MCP-1°CCL2 should be stable up to 1 week at 4°C or up to 3 months at -20°C. |
|---|---|
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−MCP-1; Monocyte Chemotactic Protein-1, CCL2, MCAF

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
RecombinantMCP-1/CCL2,Rat (orb1494632)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review