Cart summary

You have no items in your shopping cart.

RELA Rabbit Polyclonal Antibody

SKU: orb573634

Description

Rabbit polyclonal antibody to NFkB p65

Research Area

Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology, Neuroscience, Protein Biochemistry, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Porcine, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RELA
TargetRELA
Protein SequenceSynthetic peptide located within the following region: LVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
Molecular Weight60kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

p65, CMCU, NFKB3

Similar Products

  • NFKB p65 Rabbit Polyclonal Antibody [orb11118]

    FC,  ICC

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • NFKB p65 Rabbit Polyclonal Antibody [orb312399]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-NFKB p65 (Ser468) Rabbit Polyclonal Antibody [orb6503]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • Phospho-NFKB p65 (Ser536) Rabbit Polyclonal Antibody [orb6504]

    IF,  IHC-Fr,  IHC-P,  WB

    Human, Monkey, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • Phospho-NFKB p65 (Ser281) Rabbit Polyclonal Antibody [orb185656]

    FC,  WB

    Bovine, Canine, Equine, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RELA Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

RELA Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

RELA Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

RELA Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

RELA Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

RELA Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

RELA Rabbit Polyclonal Antibody

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. RELA is supported by BioGPS gene expression data to be expressed in HeLa.

RELA Rabbit Polyclonal Antibody

Rabbit Anti-RELA Antibody, Catalog Number: orb573634, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

RELA Rabbit Polyclonal Antibody

WB Suggested Anti-RELA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_068810

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

RELA Rabbit Polyclonal Antibody (orb573634)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry