You have no items in your shopping cart.
SIDT2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SIDT2 |
| Target | SIDT2 |
| Protein Sequence | Synthetic peptide located within the following region: LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT |
| Molecular Weight | 94 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SIDT2 Rabbit Polyclonal Antibody [orb186138]
WB
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μlSIDT2 Rabbit Polyclonal Antibody (HRP) [orb2126231]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
HRP
100 μlSIDT2 Rabbit Polyclonal Antibody (FITC) [orb2126232]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
FITC
100 μlSIDT2 Rabbit Polyclonal Antibody (Biotin) [orb2126233]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
Biotin
100 μlSIDT2 Rabbit Polyclonal Antibody (HRP) [orb472683]
WB
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
Human
Rabbit
Polyclonal
HRP
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. SIDT2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. SIDT2 is supported by BioGPS gene expression data to be expressed in 721_B.

Rabbit Anti-SIDT2 antibody, Catalog Number: orb577445, Paraffin Embedded Tissue: Human Placenta cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/ml. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-SIDT2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.
Quick Database Links
UniProt Details
−NCBI Reference Sequences
−| Protein | NP_001035545 |
|---|
Documents Download
Request a Document
SIDT2 Rabbit Polyclonal Antibody (orb577445)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
