Cart summary

You have no items in your shopping cart.

SLC6A5 Peptide - N-terminal region

SKU: orb2004304

Description

SLC6A5 Peptide - N-terminal region

Images & Validation

Tested ApplicationsWB
Application Notes
This is a synthetic peptide designed for use in combination with SLC6A5 Rabbit Polyclonal Antibody (orb325098). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

Molecular Weight43kDa
Protein SequenceSynthetic peptide located within the following region: KNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGE

Storage & Handling

StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SLC6A5 Peptide - N-terminal region (orb2004304)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
¥ 2,600.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry