You have no items in your shopping cart.
SLC9A3 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rabbit, Rat, Sheep |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC9A3 |
| Target | SLC9A3 |
| Protein Sequence | Synthetic peptide located within the following region: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR |
| Molecular Weight | 93kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−EBP50/NHERF-1/SLC9A3R1/NHERF Rabbit Polyclonal Antibody [orb546330]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgHydrogen exchanger 3 Rabbit Polyclonal Antibody [orb612180]
WB
Bovine, Human, Porcine, Rabbit, Sheep
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μlHydrogen exchanger 3 Rabbit Polyclonal Antibody [orb612181]
WB
Bovine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. A shorter form of this protein also contains the peptide sequence at 91 kDa, and the protein may be phosphorylated and/or glycosylated.

Sample Tissue: Human RPMI-8226, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 3 ug/mL.

WB Suggested Anti-SLC9A3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate.
Documents Download
Request a Document
SLC9A3 Rabbit Polyclonal Antibody (orb330345)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review










