You have no items in your shopping cart.
SOX4 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SOX4 |
| Target | SOX4 |
| Protein Sequence | Synthetic peptide located within the following region: STASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNA |
| Molecular Weight | 47 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SOX4 Rabbit Polyclonal Antibody [orb158462]
FC, IF, IHC-Fr, IHC-P, WB
Gallus
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlSOX4 Rabbit Polyclonal Antibody [orb574573]
IHC, WB
Bovine, Canine, Guinea pig, Mouse, Rabbit
Human
Rabbit
Polyclonal
Unconjugated
100 μlSOX4 Rabbit Polyclonal Antibody (PE) [orb498451]
FC, IF
Gallus
Human, Mouse, Rat
Rabbit
Polyclonal
PE
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Fetal Stomach, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Human Testis

lane 1: Human Testis, primary antibody: SOX4 antibody - N-terminal region (orb576583), primary antibody dilution: 1:1000, secondary antibody: goat anti-rabbit-HRP, secondary antibody dilution: 1:10000, blocking buffer: 3% milk in TBST, Actual Primary Conc (mg/mL): 0.9, Expected Primary Conc (mg/mL): 0.5.

lane 1: Human Testis, primary antibody:SOX4 antibody - N-terminal region (orb576583), primary antibody dilution: 1:1000, secondary antibody: goat anti-rabbit-HRP, secondary antibody dilution: 1:10000, blocking buffer: 3% milk in TBST, Actual Primary Conc (mg/mL): 1.9, Expected Primary Conc (mg/mL): 0.5.

WB Suggested Anti-SOX4 Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.

WB Suggested Anti-SOX4 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate.
Documents Download
Request a Document
Protocol Information
SOX4 Rabbit Polyclonal Antibody (orb576583)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review














