Cart summary

You have no items in your shopping cart.

TFRC Rabbit Polyclonal Antibody

SKU: orb333739

Description

Rabbit polyclonal antibody to CD71

Research Area

Epigenetics, Infectious Diseases

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityRabbit

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetTFRC
Protein SequenceSynthetic peptide located within the following region: PVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPRE
Molecular Weight84kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CD71 antibody, anti CD71 antigen antibody, anti Mtvr-1 antibody, anti Mtvr1 antibody, anti p90 antibody, anti sTfR antibody, anti T9 antibody, anti TFR antibody, anti TFR1 antibody, anti TFRC antibody, anti TFRC transferrin receptor (p90 CD71) antibody, anti TR antibody, anti transferrin receptor antibody, anti transferrin receptor protein 1 antibody, anti Transferrin receptor protein 1, serum form antibody, anti TRFR antibody

Similar Products

  • Transferrin Receptor/TFRC Rabbit Polyclonal Antibody [orb215987]

    FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • TFRC Rabbit Polyclonal Antibody [orb1868]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Guinea pig, Porcine, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • TFRC Rabbit Polyclonal Antibody [orb2563140]

    IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • CD71/TfR (phospho Ser24) rabbit pAb Antibody [orb769075]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CD71/TfR rabbit pAb Antibody [orb766979]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TFRC Rabbit Polyclonal Antibody

Rabbit Anti-TFRC Antibody, Catalog Number: orb333739, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

TFRC Rabbit Polyclonal Antibody

WB Suggested Anti-TFRC Antibody, Titration: 1.0 ug/ml, Positive Control: ACHN Whole Cell.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003225

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TFRC Rabbit Polyclonal Antibody (orb333739)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry