You have no items in your shopping cart.
TUBB2A Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Mouse, Rat, Sheep |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TUBB2A |
| Target | TUBB2A |
| Protein Sequence | Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC |
| Molecular Weight | 49kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−β Tubulin Rabbit pAb Antibody [orb763673]
IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlTUBB2A Rabbit Polyclonal Antibody [orb577467]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish
Human, Rat
Rabbit
Polyclonal
Unconjugated
100 μlTubb2a Rabbit Polyclonal Antibody [orb584034]
WB
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
Mouse
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Antibody Dilution: 1.0 ug/ml, Sample Type: HepG2 cell lysate. TUBB2A is supported by BioGPS gene expression data to be expressed in HepG2.

Rabbit Anti-TUBB2A Antibody, Catalog Number: orb577466, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Small intestine, myenteric plexus.
Documents Download
Request a Document
Protocol Information
TUBB2A Rabbit Polyclonal Antibody (orb577466)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





