Ablim1 Rabbit Polyclonal Antibody

SKU: orb584448

Description

Ablim1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting Ablim1. It is suitable for WB and is reactive with mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Musculoskeletal & Connective Tissue Research

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Mouse
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Target	Ablim1
Protein Sequence	Synthetic peptide located within the following region: KAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQDV
Molecular Weight	62kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Lim, abL, abLI, Limab1, AV079770, AW060987, AW215784, mKIAA0059, 2210411C18Rik, 2610209L21Rik, 4833406P10Rik, 9330196J19Rik

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Ablim1

UniProt

E9Q030

RefSeq (Protein):NP_001096648

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001096648

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols

Applications:	ELISA, IHC, WB
Reactivity:	Human, Mouse, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ELISA, IHC, WB
Predicted Reactivity:	Mouse, Rat
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ICC, IF
Predicted Reactivity:	Bovine, Canine, Gallus, Human, Porcine, Rat
Reactivity:	Mouse
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	RBITC

Applications:	ICC, IF
Predicted Reactivity:	Bovine, Canine, Gallus, Human, Porcine, Rat
Reactivity:	Mouse
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Cy7