Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ASGR1 Rabbit Polyclonal Antibody

SKU: orb574828

Description

Rabbit polyclonal antibody to ASGR1

Research Area

Epigenetics, Infectious Diseases

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Equine, Guinea pig, Mouse, Porcine, Rat, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human ASGR1
TargetASGR1
Protein SequenceSynthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
Molecular Weight33 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HL-1, ASGPR, ASGPR1, CLEC4H1

Similar Products

  • ASGR1 Rabbit Polyclonal Antibody [orb574829]

    WB

    Bovine, Equine, Guinea pig, Mouse, Porcine, Rat, Yeast

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • ASGR1 Rabbit Polyclonal Antibody [orb4635]

    ELISA,  IHC-P,  WB

    Bovine, Equine, Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • ASGR1 Antibody (N-term) [orb1935129]

    IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • ASGR1 Rabbit Polyclonal Antibody [orb624906]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • ASGR1 Rabbit Polyclonal Antibody [orb2953167]

    ELISA,  IHC,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ASGR1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

ASGR1 Rabbit Polyclonal Antibody

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. ASGR1 is supported by BioGPS gene expression data to be expressed in HepG2.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

Positive control (+): Human brain (BR), Negative control (-): Human fetal heart (HE), Antibody concentration: 1 ug/ml.

ASGR1 Rabbit Polyclonal Antibody

WB Suggested Anti-ASGR1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001662

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

ASGR1 Rabbit Polyclonal Antibody (orb574828)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry