Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

BCL2 Antibody

SKU: orb1463330

Description

Goat polyclonal antibody to BCL2. This protein belongs to a family that act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Regulates cell death by controlling the mitochondrial membrane permeability and appears to function in a feedback loop system with caspases.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
Dilution RangeWB:1:500-1:2,000
ReactivityCanine, Human, Monkey, Mouse, Rat
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Recombinant affinity purified peptide derived from within residues 143 aa to the N-terminus of human BCL2 produced in E. coli. Antigen Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVN
TargetBCL2
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
ConcentrationPlease inquire
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Apoptosis Regulator Bcl-2, BCL2 Apoptosis Regulator, B-Cell CLL/Lymphoma 2, PPP1R50, Protein Phosphatase 1 Regulatory Subunit 50 antibody.

Similar Products

  • Bax Recombinant Rabbit Monoclonal Antibody [orb608054]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Recombinant

    Unconjugated

    50 μl, 100 μl, 25 μl
  • Bax Rabbit Polyclonal Antibody [orb4655]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Beclin 1 Recombinant Rabbit Monoclonal Antibody [orb2563484]

    IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Recombinant

    Unconjugated

    50 μl, 100 μl, 200 μl, 25 μl, 200 μg
  • Beclin 1 Mouse Monoclonal Antibody [orb499660]

    IF,  IHC-Fr,  IHC-P

    Mouse, Rat

    Human, Mouse, Rat

    Mouse

    Monoclonal

    Unconjugated

    100 μl, 200 μl, 200 μg, 50 μl
  • BCL2 Rabbit Polyclonal Antibody [orb10173]

    ELISA,  ICC,  IF,  IHC-P,  WB

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

BCL2 Antibody (orb1463330)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
¥ 3,900.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 days
Bulk Enquiry