Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

BMPER Rabbit Polyclonal Antibody

SKU: orb581757

Description

Rabbit polyclonal antibody to BMPER

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human BMPER
TargetBMPER
Protein SequenceSynthetic peptide located within the following region: NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV
Molecular Weight76 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CV2, CV-2, CRIM3

Similar Products

  • BMPER Rabbit Polyclonal Antibody [orb100058]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • BMPER Rabbit Polyclonal Antibody (HRP) [orb2109083]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl
  • BMPER Rabbit Polyclonal Antibody (FITC) [orb2109084]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl
  • BMPER Rabbit Polyclonal Antibody (Biotin) [orb2109085]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

    Rabbit

    Polyclonal

    Biotin

    100 μl
  • BMPER Rabbit Polyclonal Antibody (Biotin) [orb446170]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

BMPER Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

BMPER Rabbit Polyclonal Antibody

BMPER was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb581757 with 1:200 dilution. Western blot was performed using orb581757 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: BMPER IP with orb581757 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

BMPER Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

BMPER Rabbit Polyclonal Antibody

Human Lung

BMPER Rabbit Polyclonal Antibody

Human Lung

BMPER Rabbit Polyclonal Antibody

Immunohistochemistry with Human Lung, respiratory epethelium tissue at an antibody concentration of 5.0 ug/ml using anti-BMPER antibody (orb581757).

BMPER Rabbit Polyclonal Antibody

WB Suggested Anti-BMPER Antibody Titration: 1 ug/ml, Positive Control: Fetal heart lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_597725

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

BMPER Rabbit Polyclonal Antibody (orb581757)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody Gifts (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry