Cart summary

You have no items in your shopping cart.

Bovine CXCL10 protein

SKU: orb1216341

Description

The Bovine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL10 Specifications: (Molecular Weight: 9.3 kDa) (Amino Acid Sequence: VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA) (Gene ID: 615107).

Images & Validation

Key Properties

SourceYeast
Biological OriginBovine
TargetCXCL10
Molecular Weight9.3 kDa
Protein Length83.0
Protein SequenceVPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

IP-10

Similar Products

  • Bovine IP-10 protein [orb435735]

    ELISA,  WB

    >95% by SDS PAGE analysis

    5 μg
  • Bovine IP10 ELISA Kit (Ready to Use) [orb549236]

    Bovine

    0.156-10 ng/mL

    0.058 ng/mL

    48 T, 96 T
  • Bovine IP10 ELISA Kit [orb437390]

    Bovine

    0.156-10 ng/mL

    0.058 ng/mL

    48 T, 96 T
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Bovine CXCL10 protein (orb1216341)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
¥ 3,900.00
25 μg
¥ 7,020.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry