Cart summary

You have no items in your shopping cart.

C1QTNF12 Rabbit Polyclonal Antibody

SKU: orb587402

Description

Rabbit polyclonal antibody to C1QTNF12

Research Area

Epigenetics

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityZebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM132A
TargetC1QTNF12
Protein SequenceSynthetic peptide located within the following region: MRRWAWAAVVVLLGPQLVLLGGVGARREAQRTQQPGQRADPPNATASASS
Molecular Weight30kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

C1QDC2, CTRP12, FAM132A

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

C1QTNF12 Rabbit Polyclonal Antibody

Sample Type: MCF7 Whole cell lysates, Antibody dilution: 1.0 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

C1QTNF12 Rabbit Polyclonal Antibody (orb587402)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry