Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CCT8 Rabbit Polyclonal Antibody

SKU: orb579589

Description

Rabbit polyclonal antibody to CCT8

Research Area

Disease Biomarkers

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CCT8
TargetCCT8
Protein SequenceSynthetic peptide located within the following region: DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
Molecular Weight59kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Cctq, PRED71, D21S246, C21orf112

Similar Products

  • TCP1 theta/CCT8 Rabbit Polyclonal Antibody [orb371727]

    FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • TCP-1 θ rabbit pAb Antibody [orb767411]

    ELISA,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • CCT8 Antibody [orb672457]

    ELISA,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • CCT8 Rabbit Polyclonal Antibody [orb579588]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • CCT8 Rabbit Polyclonal Antibody [orb625539]

    ELISA,  IF,  WB

    Human, Mouse, Rat, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CCT8 Rabbit Polyclonal Antibody

CCT8 antibody - C-terminal region (orb579589) validated by WB using HEK 293T at 1:1000 dilution for antibody samples and 1:10000 for secondary antibodies. CCT8 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

CCT8 Rabbit Polyclonal Antibody

CCT8 antibody - C-terminal region (orb579589) validated by WB using human lymphoblastoid & mouse brain.

CCT8 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

CCT8 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

CCT8 Rabbit Polyclonal Antibody

WB Suggested Anti-CCT8 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. CCT8 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006576

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CCT8 Rabbit Polyclonal Antibody (orb579589)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry