Cart summary

You have no items in your shopping cart.

CD63 Antibody

SKU: orb11597

Description

CD63 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of the members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. These proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker.

Images & Validation

Tested ApplicationsIF, IHC-Fr, IHC-P, WB
Dilution RangeWB:1:500-1:5,000, IF:1:25-1:250, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
ReactivityCanine, Human, Monkey, Mouse, Rat
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

Antibody TypePrimary Antibody
HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. Antigen Sequence: MENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCI
TargetLysosome-associated membrane glycoprotein 3
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesPBS, 20% glycerol and 0.05% sodium azide
Concentration1 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CD63 antigen, CD63 antigen (melanoma 1 antigen), granulophysin, LAMP-3, lysosomal-associated membrane protein 3, lysosome-associated membrane glycoprotein 3, ME491, melanoma-associated antigen, melanoma 1 antigen, melanoma-associated antigen ME491, MLA1, ocular melanoma-associated antigen, OMA81H, tetraspanin-30, TSPAN30 antibody.

Similar Products

  • CD63 Antibody / LAMP-3 [orb749338]

    FACS,  IF,  IHC-P,  WB

    Human, Mouse

    Mouse

    Monoclonal

    Unconjugated

    100 μg, 20 μg
  • CD63 Antibody / LAMP-3 [orb2637615]

    FACS,  IF,  IHC-P,  WB

    Human, Mouse

    Mouse

    Monoclonal

    Unconjugated

    100 μg
  • CD63 antibody [orb11317]

    ELISA,  IHC-P,  WB

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CD63 Antibody (C-term) [orb1930560]

    FC,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    200 μl
  • CD63 Antibody [orb388930]

    FC,  IF,  IHC,  WB

    Human

    Mouse

    Monoclonal

    Unconjugated

    20 μg, 100 μg, 100 μg (without BSA and Azide)
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CD63 Antibody

Anti-CD63 Ab at 1/2,500 dilution; lysate at 50 µg per lane; Rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution.

CD63 Antibody

IHC of mouse spleen using anti-CD63 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD63 Ab at 1:500/DAB detection.

CD63 Antibody

Immunofluorescence – anti-CD63 Ab in Hepa1-6 cells at 1/50 dilution; cells were fixed with 4% of PFA.

CD63 Antibody

IHC of human pancreas using anti-CD63 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD63 Ab at 1:500/DAB detection.

CD63 Antibody

Anti-CD63 Ab at 1/2,500 dilution; lysate at 50 µg per lane; Rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution.

CD63 Antibody

IHC of human cervix using anti-CD63 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD63 Ab at 1:500/DAB detection.

CD63 Antibody

Immunofluorescence – anti-CD63 Ab in Hepa1-6 cells at 1/50 dilution; cells were fixed with 4% of PFA.

CD63 Antibody

IHC of rat eye using anti-CD63 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD63 Ab at 1:500/DAB detection.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol
IHC-Fr
Immunohistochemistry Frozen
View Protocol
IF
Immunofluorescence
View Protocol

CD63 Antibody (orb11597)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
¥ 3,640.00
DispatchUsually dispatched within 2-3 days
Bulk Enquiry