You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC-P, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | CDK4 |
| Protein Sequence | Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
| Molecular Weight | 34kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CDK4 Rabbit Polyclonal Antibody [orb10358]
FC, ICC, IF, IHC-Fr, IHC-P, WB
Bovine, Porcine
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μlCdk4 Polyclonal Antibody [orb1411572]
IF, IHC-P, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl[KO Validated] CDKN2A/p16INK4a Rabbit pAb [orb129709]
ELISA, IF, WB
Human
Rabbit
Polyclonal
Unconjugated

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CDK4 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb573611 with 1:200 dilution. Western blot was performed using orb573611 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: CDK4 IP with orb573611 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Lanes: 1. 30 ug human HCT116 cell lysate, 2. 30 ug genotoxic treated human HCT116 cell lysate, 3. 30 ug genotoxic treated human HCT116 cell lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: CDK4.

Lanes: Lane 1: 30 ug untreated human HCT116 cell lysate, Lane 2-3: 30 ug genotoxic agent treated human HCT116 cell lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: CDK4, CDK4 is supported by BioGPS gene expression data to be expressed in HCT116.

Rabbit Anti-CDK4 antibody, Catalog Number: orb573611, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CDK4 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
Documents Download
Request a Document
Protocol Information
CDK4 Rabbit Polyclonal Antibody (orb573611)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




















![[KO Validated] CDKN2A/p16INK4a Rabbit pAb](/images/pub/media/catalog/product/NewWebsite/2/orb129709_1.png)
![[KO Validated] CDKN2A/p16INK4a Rabbit pAb](/images/pub/media/catalog/product/NewWebsite/2/orb129709_2.png)
![[KO Validated] CDKN2A/p16INK4a Rabbit pAb](/images/pub/media/catalog/product/NewWebsite/2/orb129709_3.png)
![[KO Validated] CDKN2A/p16INK4a Rabbit pAb](/images/pub/media/catalog/product/NewWebsite/2/orb129709_4.png)



