Clcn5 Rabbit Polyclonal Antibody

SKU: orb575317

This product can be custom made

Description

Rabbit polyclonal antibody to Clcn5

Research Area

Pharmacology & Drug Discovery

Images & Validation

−

Item 1 of 10

Tested Applications	WB
Reactivity	Mouse, Rat
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Sheep, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Target	Clcn5
Protein Sequence	Synthetic peptide located within the following region: LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL
Molecular Weight	83kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Clc, ClC-, Clc5, Sfc1, ClC-5, Clc4-, Clcn4, Sfc13, Clc4-1, T25545, Clcn4-1, DXImx42, DXImx42e, 5430408K11Rik, D930009B12Rik

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Rat Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: Rat Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Rat Muscle, Antibody dilution: 1.0 ug/ml.

Sample Type: Mouse Spleen, Antibody dilution: 1.0 ug/ml.

Sample Type: Rat Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Mouse Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Mouse Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Mouse Kidney, Antibody dilution: 1.0 ug/ml.

Sample Type: Mouse Liver, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-Clcn5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Brain.

Quick Database Links

Gene Symbol

Clcn5

UniProt

Q9WVD4

RefSeq (Protein):NP_057900

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_057900

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols