You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CPXCR1 |
| Target | CPXCR1 |
| Protein Sequence | Synthetic peptide located within the following region: WANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIV |
| Molecular Weight | 35kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CPXCR1 Rabbit Polyclonal Antibody [orb626012]
ELISA, IP, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Anti-CPXCR1 antibody IHC staining of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.

Anti-CPXCR1 antibody IHC staining of human thymus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.

Rabbit Anti-CPXCR1 Antibody, Paraffin Embedded Tissue: Human Tymus, Antibody Concentration: 10 ug/ml.

WB Suggested Anti-CPXCR1 Antibody Titration: 1 ug/ml, Positive Control: Fetal Brain Lysate.
Documents Download
Request a Document
Protocol Information
CPXCR1 Rabbit Polyclonal Antibody (orb577268)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


