Cart summary

You have no items in your shopping cart.

CYP1A1 Rabbit Polyclonal Antibody

SKU: orb578043

Description

Rabbit polyclonal antibody to CYP1A1

Research Area

Cell Biology, Disease Biomarkers, Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CYP1A1
TargetCYP1A1
Protein SequenceSynthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV
Molecular Weight58 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX

Similar Products

  • Cytochrome P450 1A1/CYP1A1 Rabbit Polyclonal Antibody [orb308839]

    FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CYP1A1 Rabbit Polyclonal Antibody [orb10136]

    IF,  IHC-Fr,  IHC-P,  WB

    Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • CYP1A1/2 rabbit pAb Antibody [orb764968]

    ELISA,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CYP1A1 Rabbit Polyclonal Antibody [orb578044]

    WB

    Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Cytochrome P450 1A1/2 Antibody [orb213814]

    IF,  WB

    Canine, Human, Monkey, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 30 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CYP1A1 Rabbit Polyclonal Antibody

Sample Type: Human Kidney, Dilution: 1:100.

CYP1A1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

CYP1A1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

CYP1A1 Rabbit Polyclonal Antibody

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/ml.

CYP1A1 Rabbit Polyclonal Antibody

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.

CYP1A1 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.

CYP1A1 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.

CYP1A1 Rabbit Polyclonal Antibody

Sample Tissue: Human Liver Tumor, Antibody Dilution: 1 ug/ml.

CYP1A1 Rabbit Polyclonal Antibody

WB Suggested Anti-CYP1A1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000490

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

CYP1A1 Rabbit Polyclonal Antibody (orb578043)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry